General Information

  • ID:  hor000819
  • Uniprot ID:  Q5W1L4
  • Protein name:  Corazonin
  • Gene name:  Crz
  • Organism:  Drosophila erecta (Fruit fly)
  • Family:  Corazonin family
  • Source:  Animal
  • Expression:  Expression is restricted to 24 neurons in the larval CNS (8 in the brain and 16 in the ventral nerve cord) and 12-16 neurons in the pars lateralis of the adult brain.
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  melanogaster subgroup, melanogaster group, Sophophora (subgenus), Drosophila (genus), Drosophilini (tribe), Drosophilinae (subfamily), Drosophilidae (family), Ephydroidea (superfamily), Acalyptratae, Schizophora, Cyclorrhapha, Eremoneura, Muscomorpha (infraorder), Brachycera (suborder), Diptera (order), Endopterygota (cohort), Neoptera (infraclass), Pterygota (subclass), Dicondylia, Insecta (class), Hexapoda (subphylum), Pancrustacea, Mandibulata, Arthropoda (phylum), Panarthropoda, Ecdysozoa, Protostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  GO:0005184 neuropeptide hormone activity; GO:0071858 corazonin receptor binding
  • GO BP:  GO:0006117 acetaldehyde metabolic process; GO:0007218 neuropeptide signaling pathway; GO:0007619 courtship behavior; GO:0045823 positive regulation of heart contraction; GO:0048149 behavioral response to ethanol; GO:0071361 cellular response to ethanol
  • GO CC:  GO:0005576 extracellular region; GO:0005615 extracellular space

Sequence Information

  • Sequence:  QTFQYSRGWTN
  • Length:  11(20-30)
  • Propeptide:  MLRLLLLPLFLFTLSMCMGQTFQYSRGWTNGKRSFNAASPLLTTGHLHRGSELGLSDLYDLQEWTSDRRLERCLSQLQRSLIARNCVPGSDFNANRVDPDPESSAHPRLGNINNENVLYSSANVPTRHRQSNELLEELSAAGGASAEPNVFGKH
  • Signal peptide:  MLRLLLLPLFLFTLSMCMG
  • Modification:  T1 Pyrrolidone carboxylic acid;T11 Asparagine amide
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  Be involved in the physiological regulation of the heart beat
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:  NA
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-Q5W1L4-F1(AlphaFold_DB_ID)
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    hor000819_AF2.pdbhor000819_ESM.pdb

Physical Information

Mass: 156601 Formula: C62H86N18O19
Absent amino acids: ACDEHIKLMPV Common amino acids: QT
pI: 9.35 Basic residues: 1
Polar residues: 6 Hydrophobic residues: 2
Hydrophobicity: -154.55 Boman Index: -3507
Half-Life: 0.8 hour Half-Life Yeast: 10 min
Half-Life E.Coli: >10 hour Aliphatic Index 0
Instability Index: 713.64 Extinction Coefficient cystines: 6990
Absorbance 280nm: 699

Literature

  • PubMed ID:  NA
  • Title:  NA